PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 27961.m000091
Common NameLOC8268675, RCOM_0129350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family NAC
Protein Properties Length: 346aa    MW: 38342 Da    PI: 8.6875
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
27961.m000091genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.81e-53151421128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                    lppGfrFhPtdeelvv+yLkkk+++ +l++  +i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+vl++ 
  27961.m000091  15 LPPGFRFHPTDEELVVHYLKKKASSAPLPV-AIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGVRPNRAATSGYWKATGTDKPVLTSg 109
                    79****************************.88***************988899***************************************997 PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    ++++vg+kk Lvfy g+ pkg kt+W+mheyrl
  27961.m000091 110 GTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 142
                    7788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.5E-659176IPR003441NAC domain
PROSITE profilePS5100561.70915176IPR003441NAC domain
PfamPF023653.5E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MESTDSSSGS QQPNLPPGFR FHPTDEELVV HYLKKKASSA PLPVAIIAEV DLYKFDPWEL  60
PAKATFGEQE WYFFSPRDRK YPNGVRPNRA ATSGYWKATG TDKPVLTSGG TQKVGVKKAL  120
VFYGGKPPKG IKTNWIMHEY RLADNKVSNK PPGCDLANKK NSLRLDDWVL CRIYKKNNTN  180
RPMDQEKDDS MEDMLGSIPP SLTIGSQQNA RLQLLKGTNY GTLVENDTSF FNDHSISNTN  240
SISQLASSTC SRPGDLSMLP LKRTLPSLYW SDDVDMAASP SSSKRYQGDH TGDESVVRSD  300
GNGSFVSLLS QLPQTPPLHQ QQATLGSIGD GIFRPPYQLS GLNWYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-7411781170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002532683.10.0PREDICTED: NAC transcription factor 56
SwissprotQ9LD441e-131NAC56_ARATH; NAC transcription factor 56
TrEMBLB9T3640.0B9T364_RICCO; NAC domain-containing protein, putative
STRINGPOPTR_0011s12420.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-124NAC domain containing protein 2